Structure of PDB 7ki3 Chain D

Receptor sequence

>7ki3D (length=783) Species: 9606 (Homo sapiens) [Search protein sequence]

AFKPPPRPDFGTSGRTIKLQANFFEMDIPKIDIYHYELDICPRRVNREIV
EHMVQHFIFGDRKPVFDGRKNLYKVELEVTLPGEGKDRIFKVSIKVSCVS
LQALHDALSGRLPSVPFETIQALDVVMRHLPSMRYTPVGRSFFTASEGCS
NPLGGGREVWFGFHQSVRPSLWKMMLNIDVSATAFYKAQPVIEFVCEVLD
FKSIEEQQKTDSQRVKFTKEIKGLKVEITHCGQMKRKYRVCNVTPASHQT
FPTVAQYFKDRHKLVLRYPHLPCLQVGQETYLPLEVCNIVAGQRCIKKLT
DNQTSTMIRATARSAPDRQEEISKLMRSADFNTDPYVREFGIMVKDEMTD
VTGRVLQPPSILYGGRNKAIATPVQGVWDMRNKQFHTGIEIKVWAIACFA
PQRQCTEVHLKSFTEQLRKISRDAGMPIQGQPCFCKYAQGADSVEPMFRH
LKNTYAGLQLVVVILPGKTPVYAEVKRVGDTVLGMATQCVQMKNVQRTTP
QTLSNLCLKINVKLGGVNNILLPQGRPPVFQQPVIFLGADVTHPPAGKKP
SIAAVVGSMDAHPNRYCATVRVQQHRQEIIQDLAAMVRELLIQFYKSTRF
KPTRIIFYRDGVSEGQFQQVLHHELLAIREACIKLEKDYQPGITFIVVQK
RHHTRLFCTDKNERVGKSGNIPAGTTVDTKITHPTEFDFYLCSHAGIQGT
SRPSHYHVLWDDNRFSSDELQILTYQLCHTYVRCTRSVSIPAPAYYAHLV
AFRARYHLVDKDHQALAKAVQVHQDTLRTMYFA

3D structure

PDB

7ki3 A structured RNA motif locks Argonaute2:miR-122 onto the 5' end of the HCV genome.

Chain

Resolution

3.0 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

3.1.26.n2: argonaute-2.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	D	F294 Y311 R315 T337 Y338 T368 L522 G524 T526 Y529 K533 Q545 C546 Q548 N551 T559 N562 K566 K570 H753 I756 Q757 T759 S760 R761 Y790 R792 C793 S798 Y804	F251 Y257 R261 T280 Y281 T311 L465 G467 T469 Y472 K476 Q488 C489 Q491 N494 T502 N505 K509 K513 H694 I697 Q698 T700 S701 R702 Y731 R733 C734 S739 Y745
BS02	rna	D	K263 R438 P557 Q558 P601 P602 A603 K608 Q757 F811 R814	K222 R381 P500 Q501 P544 P545 A546 K549 Q698 F752 R755

Gene Ontology

	Molecular Function
GO:0000340	RNA 7-methylguanosine cap binding
GO:0000993	RNA polymerase II complex binding
GO:0001046	core promoter sequence-specific DNA binding
GO:0003676	nucleic acid binding
GO:0003723	RNA binding
GO:0003725	double-stranded RNA binding
GO:0003727	single-stranded RNA binding
GO:0003729	mRNA binding
GO:0003743	translation initiation factor activity
GO:0004519	endonuclease activity
GO:0004521	RNA endonuclease activity
GO:0005515	protein binding
GO:0016891	RNA endonuclease activity, producing 5'-phosphomonoesters
GO:0035197	siRNA binding
GO:0035198	miRNA binding
GO:0035925	mRNA 3'-UTR AU-rich region binding
GO:0046872	metal ion binding
GO:0061980	regulatory RNA binding
GO:0070551	endoribonuclease activity, cleaving siRNA-paired mRNA
GO:0090624	endoribonuclease activity, cleaving miRNA-paired mRNA
GO:0098808	mRNA cap binding

	Biological Process
GO:0006355	regulation of DNA-templated transcription
GO:0006412	translation
GO:0006413	translational initiation
GO:0006417	regulation of translation
GO:0009791	post-embryonic development
GO:0010501	RNA secondary structure unwinding
GO:0010586	miRNA metabolic process
GO:0010628	positive regulation of gene expression
GO:0030422	siRNA processing
GO:0031047	regulatory ncRNA-mediated gene silencing
GO:0031054	pre-miRNA processing
GO:0033962	P-body assembly
GO:0035194	regulatory ncRNA-mediated post-transcriptional gene silencing
GO:0035196	miRNA processing
GO:0035278	miRNA-mediated gene silencing by inhibition of translation
GO:0035279	miRNA-mediated gene silencing by mRNA destabilization
GO:0042985	negative regulation of amyloid precursor protein biosynthetic process
GO:0045727	positive regulation of translation
GO:0045766	positive regulation of angiogenesis
GO:0045944	positive regulation of transcription by RNA polymerase II
GO:0045947	negative regulation of translational initiation
GO:0060213	positive regulation of nuclear-transcribed mRNA poly(A) tail shortening
GO:0070922	RISC complex assembly
GO:0090128	regulation of synapse maturation
GO:0090625	siRNA-mediated gene silencing by mRNA destabilization
GO:1900153	positive regulation of nuclear-transcribed mRNA catabolic process, deadenylation-dependent decay
GO:1901165	positive regulation of trophoblast cell migration

	Cellular Component
GO:0000932	P-body
GO:0005634	nucleus
GO:0005654	nucleoplasm
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0016020	membrane
GO:0016442	RISC complex
GO:0030425	dendrite
GO:0036464	cytoplasmic ribonucleoprotein granule
GO:0043232	intracellular non-membrane-bounded organelle
GO:0070062	extracellular exosome
GO:0070578	RISC-loading complex
GO:0098794	postsynapse
GO:0098978	glutamatergic synapse
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:7ki3, PDBe:7ki3, PDBj:7ki3
PDBsum	7ki3
PubMed	34824224
UniProt	Q9UKV8\|AGO2_HUMAN Protein argonaute-2 (Gene Name=AGO2)

[Back to BioLiP]