Structure of PDB 7kb8 Chain D

Receptor sequence
>7kb8D (length=87) Species: 10090 (Mus musculus) [Search protein sequence]
YEESKPFTCLDGTATIPFDQVNDDYCDCKDGSDEPGTAACPNGSFHCTNT
GYKPLYILSSRVNDGVCDCCDGTDEYNSGTVCENTCR
3D structure
PDB7kb8 N-Substituted Valiolamine Derivatives as Potent Inhibitors of Endoplasmic Reticulum alpha-Glucosidases I and II with Antiviral Activity.
ChainD
Resolution2.385 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 CA D Q50 D53 Y55 D57 D63 E64 Q20 D23 Y25 D27 D33 E34
BS02 CA D R91 D94 V96 D98 D104 E105 R61 D64 V66 D68 D74 E75
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0005509 calcium ion binding
GO:0005515 protein binding
GO:0044877 protein-containing complex binding
GO:0046872 metal ion binding
Biological Process
GO:0001701 in utero embryonic development
GO:0001889 liver development
GO:0006491 N-glycan processing
GO:0010977 negative regulation of neuron projection development
GO:0071941 nitrogen cycle metabolic process
Cellular Component
GO:0005783 endoplasmic reticulum
GO:0017177 glucosidase II complex
GO:0043231 intracellular membrane-bounded organelle

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7kb8, PDBe:7kb8, PDBj:7kb8
PDBsum7kb8
PubMed34870992
UniProtO08795|GLU2B_MOUSE Glucosidase 2 subunit beta (Gene Name=Prkcsh)

[Back to BioLiP]