Structure of PDB 7k9q Chain D

Receptor sequence

>7k9qD (length=88) Species: 10090 (Mus musculus) [Search protein sequence]

FYEESKPFTCLDGTATIPFDQVNDDYCDCKDGSDEPGTAACPNGSFHCTN
TGYKPLYILSSRVNDGVCDCCDGTDEYNSGTVCENTCR

3D structure

PDB

7k9q N-Substituted Valiolamine Derivatives as Potent Inhibitors of Endoplasmic Reticulum alpha-Glucosidases I and II with Antiviral Activity.

Chain

Resolution

2.3 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	CA	D	Q50 D53 Y55 D57 D63 E64	Q21 D24 Y26 D28 D34 E35
BS02	CA	D	R91 D94 V96 D98 D104 E105	R62 D65 V67 D69 D75 E76

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0005509	calcium ion binding
GO:0005515	protein binding
GO:0044877	protein-containing complex binding
GO:0046872	metal ion binding

	Biological Process
GO:0001701	in utero embryonic development
GO:0001889	liver development
GO:0006491	N-glycan processing
GO:0010977	negative regulation of neuron projection development
GO:0071941	nitrogen cycle metabolic process

	Cellular Component
GO:0005783	endoplasmic reticulum
GO:0017177	glucosidase II complex
GO:0043231	intracellular membrane-bounded organelle

External links

PDB	RCSB:7k9q, PDBe:7k9q, PDBj:7k9q
PDBsum	7k9q
PubMed	34870992
UniProt	O08795\|GLU2B_MOUSE Glucosidase 2 subunit beta (Gene Name=Prkcsh)