Structure of PDB 7jz2 Chain D

Receptor sequence
>7jz2D (length=113) Species: 83333 (Escherichia coli K-12) [Search protein sequence]
SNASALGRNGVHDFILVRATAIVLTLYIIYMVGFFATSGELTYEVWIGFF
ASAFTKVFTLLALFSILIHAWIGMWQVLTDYVKPLALRLMLQLVIVVALV
VYVIYGFVVVWGV
3D structure
PDB7jz2 A 'Build and Retrieve' methodology to simultaneously solve cryo-EM structures of membrane proteins.
ChainD
Resolution2.5 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 HEM D A23 L26 T27 I68 H71 G75 V79 A21 L24 T25 I66 H69 G73 V77
Gene Ontology
--> -->
 
 
UnboundLocalError
Python 3.6.8: /usr/bin/python3
Sat Nov 16 17:31:21 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)
   1444         else:
=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)
   1446     
   1447     uniprot_line=''
pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '7jz2', asym_id = 'D', title = "A 'Build and Retrieve' methodology to simultaneously solve cryo-EM structures of membrane proteins. "
 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='7jz2', asym_id='D', title="A 'Build and Retrieve' methodology to simultaneously solve cryo-EM structures of membrane proteins. ")
    839 
    840     if go:
=>  841         display_go(go,uniprot,pdbid,asym_id)
    842     return pubmed,uniprot
    843 
global display_go = <function display_go>, go = '0006099,0016020,0020037', uniprot = '', pdbid = '7jz2', asym_id = 'D'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0006099,0016020,0020037', uniprot='', pdbid='7jz2', asym_id='D')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>