Structure of PDB 7jxq Chain D

Receptor sequence

>7jxqD (length=298) Species: 9606 (Homo sapiens)

NQALLRILKETEFKKIKVLGSGAFGTVYKGLWIPEGEKVKIPVAIKELRE
ATSPKANKEILDEAYVMASVDNPHVCRLLGICLTSTVQLIMQLMPFGCLL
DYVREHKDNIGSQYLLNWCVQIAKGMNYLEDRRLVHRDLAARNVLVKTPQ
HVKITDFGLAKLLGAEVPIKWMALESILHRIYTHQSDVWSYGVTVWELMT
FGSKPYDGIPASEISSILEKGERLPQPPICTIDVYMIMRKCWMIDADSRP
KFRELIIEFSKMARDPQRYLVIQGDERMHLPSPTDSNFYRALMDEEDM

3D structure

• PDB: 7jxq An allosteric inhibitor against the therapy-resistant mutant forms of EGFR in non-small cell lung cancer.
• Chain: D
• Resolution: 1.83 Å

Enzymatic activity

• Enzyme Commision number: 2.7.10.1: receptor protein-tyrosine kinase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	MG	D	N842 D855	N143 D156
BS02	ANP	D	G719 S720 G721 A722 V726 A743 K745 M790 M793 C797 D837 R841 N842 L844 D855	G20 S21 G22 A23 V27 A44 K46 M91 M94 C98 D138 R142 N143 L145 D156
BS03	VNS	D	A743 K745 I759 M766 R776 L777 L788 M790 D855 F856 L858 L861	A44 K46 I60 M67 R77 L78 L89 M91 D156 F157 L159 L162

Gene Ontology

Molecular Function

• GO:0004672 protein kinase activity
• GO:0004713 protein tyrosine kinase activity
• GO:0005524 ATP binding

Biological Process

• GO:0006468 protein phosphorylation

External links

• PDB: RCSB:7jxq, PDBe:7jxq, PDBj:7jxq
• PDBsum: 7jxq
• PubMed: 35422503
• UniProt: P00533|EGFR_HUMAN Epidermal growth factor receptor (Gene Name=EGFR)