Structure of PDB 7exc Chain D

Receptor sequence

>7excD (length=421) Species: 9823 (Sus scrofa)

MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVY
YNEAAGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNN
WAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTL
LISKIREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETY
CIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADL
RKLAVNMVPFPRLHFFMPGFAPLLTVPELTQQMFDAKNMMAACDPRHGRY
LTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRG
LKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTE
AESNMNDLVSEYQQYQDATAD

3D structure

• PDB: 7exc Structure-Based Design and Synthesis of N-Substituted 3-Amino-beta-Carboline Derivatives as Potent alpha beta-Tubulin Degradation Agents
• Chain: D
• Resolution: 2.39 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	GTP	D	G10 Q11 C12 Q15 N99 S138 G141 G142 T143 S176 E181 N204 Y222 N226	G10 Q11 C12 Q15 N99 S138 G141 G142 T143 S176 E181 N204 Y222 N226
BS02	JEL	D	F20 Q134 T136 N165 F167 E198 Y200 M233 V236 L240 L253 M257 A314 V316 A352	F20 Q134 T136 N165 F167 E198 Y200 M233 V236 L240 L253 M257 A304 V306 A342
BS03	MG	D	Q11 E69	Q11 E69

Gene Ontology

Molecular Function

• GO:0003924 GTPase activity
• GO:0005200 structural constituent of cytoskeleton
• GO:0005515 protein binding
• GO:0005525 GTP binding
• GO:0046872 metal ion binding

Biological Process

• GO:0000226 microtubule cytoskeleton organization
• GO:0000278 mitotic cell cycle
• GO:0007017 microtubule-based process

Cellular Component

• GO:0005737 cytoplasm
• GO:0005856 cytoskeleton
• GO:0005874 microtubule

External links

• PDB: RCSB:7exc, PDBe:7exc, PDBj:7exc
• PDBsum: 7exc
• UniProt: P02554|TBB_PIG Tubulin beta chain