Structure of PDB 7e9c Chain D

Receptor sequence
>7e9cD (length=93) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence]
VRKETYSSYIYKVLKQTHPDTGISQKSMSILNSFVNDIFERIATEASKLA
AYNKKSTISAREIQTAVRLILPGELAKHAVSEGTRAVTKYSSS
3D structure
PDB7e9c Nucleosome binding relinquishes the association of the BAH domain of Orc1 with Sir1
ChainD
Resolution3.5 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna D S42 Y43 S8 Y9
BS02 dna D Y45 K49 K89 Y11 K15 K55
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Biological Process
GO:0006325 chromatin organization
GO:0006355 regulation of DNA-templated transcription
Cellular Component
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005694 chromosome
GO:0031298 replication fork protection complex
GO:0032991 protein-containing complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7e9c, PDBe:7e9c, PDBj:7e9c
PDBsum7e9c
PubMed
UniProtP02294|H2B2_YEAST Histone H2B.2 (Gene Name=HTB2)

[Back to BioLiP]