Structure of PDB 7bxt Chain D

Receptor sequence
>7bxtD (length=94) Species: 9606 (Homo sapiens) [Search protein sequence]
RSRKESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRL
AHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSS
3D structure
PDB7bxt Cryo-EM structure of the CENP-A nucleosome in complex with phosphorylated CENP-C.
ChainD
Resolution4.2 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna D S32 Y42 S55 S56 R86 S87 S2 Y12 S25 S26 R56 S57
BS02 dna D R33 I39 Y40 R3 I9 Y10
BS03 peptide D Q47 V48 H49 H109 Q17 V18 H19 H79
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Biological Process
GO:0002227 innate immune response in mucosa
GO:0006334 nucleosome assembly
GO:0019731 antibacterial humoral response
GO:0042742 defense response to bacterium
GO:0050830 defense response to Gram-positive bacterium
GO:0061844 antimicrobial humoral immune response mediated by antimicrobial peptide
Cellular Component
GO:0000786 nucleosome
GO:0005615 extracellular space
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005694 chromosome
GO:0005829 cytosol
GO:0070062 extracellular exosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7bxt, PDBe:7bxt, PDBj:7bxt
PDBsum7bxt
PubMed33463726
UniProtQ16778|H2B2E_HUMAN Histone H2B type 2-E (Gene Name=H2BC21)

[Back to BioLiP]