Structure of PDB 7b9v Chain D

Receptor sequence

>7b9vD (length=194) Species: 4932 (Saccharomyces cerevisiae)

SERKAINKYYPPDYNPLEAEKLSRKMAKKLKTMNKSHASIRLMTPFSMRC
LECNEYIPKSRKFNGKKELLKEKYLDSIKIYRLTISCPRCANSIAFRTDP
GNSDYVMEVGGVRNYSIDETLQRLVREKEMEQNEDKMDLLEKRLAKIQQE
QEDDEELENLRKKNLEMSQRAEMINRSAAAAAAAAAAAAAAAAA

3D structure

• PDB: 7b9v Structural basis for conformational equilibrium of the catalytic spliceosome.
• Chain: D
• Resolution: 2.8 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	D	R4 K9 R25	R3 K8 R24
BS02	rna	D	K32 T33 R42 P59 S61 R62 K63 N65	K31 T32 R41 P58 S60 R61 K62 N64
BS03	rna	D	R4 K22 S37 H38 I41 R42 K68 L70 K80 Y82	R3 K21 S36 H37 I40 R41 K67 L69 K79 Y81
BS04	ZN	D	C51 C54 C88 C91	C50 C53 C87 C90

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Fri Nov 15 18:18:08 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)

   1444         else:

=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)

   1446     

   1447     uniprot_line=''

pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '7b9v', asym_id = 'D', title = 'Structural basis for conformational equilibrium of the catalytic spliceosome.'

 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='7b9v', asym_id='D', title='Structural basis for conformational equilibrium of the catalytic spliceosome.')

    839 

    840     if go:

=>  841         display_go(go,uniprot,pdbid,asym_id)

    842     return pubmed,uniprot

    843 

global display_go = <function display_go>, go = '0000398', uniprot = '', pdbid = '7b9v', asym_id = 'D'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0000398', uniprot='', pdbid='7b9v', asym_id='D')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>