Structure of PDB 7b24 Chain D

Receptor sequence
>7b24D (length=142) Species: 405948 (Saccharopolyspora erythraea NRRL 2338) [Search protein sequence]
NDLIDTTEMYLRTIYDLEEEGVVPLRARIAERLEQSGGTVSQTVARMERD
GLLTVAEDRHLELTKAGRARAISVMRKHRLAERLLVDVIGLEWEQVHLEA
CRWEHVMSEAVERKLVKLLGNPTTSPYGNPIPGLDELGVGDS
3D structure
PDB7b24 The bacterial iron sensor IdeR recognizes its DNA targets by indirect readout.
ChainD
Resolution2.05 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna D T7 Q36 S37 T40 Q43 R47 R50 T6 Q35 S36 T39 Q42 R46 R49
BS02 dna D A28 R29 S42 R60 A27 R28 S41 R59
BS03 CO D H79 E83 H98 H78 E82 H97
BS04 CO D M10 C102 E105 H106 M9 C101 E104 H105
Gene Ontology
--> -->
 
 
UnboundLocalError		Python 3.6.8: /usr/bin/python3
Thu Nov 28 21:56:17 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)
   1444         else:
=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)
   1446     
   1447     uniprot_line=''
pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '7b24', asym_id = 'D', title = 'The bacterial iron sensor IdeR recognizes its DNA targets by indirect readout.'
 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='7b24', asym_id='D', title='The bacterial iron sensor IdeR recognizes its DNA targets by indirect readout.')
    839 
    840     if go:
=>  841         display_go(go,uniprot,pdbid,asym_id)
    842     return pubmed,uniprot
    843 
global display_go = <function display_go>, go = '0003677,0003700,0006355,0046914,0046983', uniprot = '', pdbid = '7b24', asym_id = 'D'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003677,0003700,0006355,0046914,0046983', uniprot='', pdbid='7b24', asym_id='D')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>