Structure of PDB 7aqd Chain D

Receptor sequence

>7aqdD (length=207) Species: 224308 (Bacillus subtilis subsp. subtilis str. 168)

TKGILGRKIGMTQVFAENGDLIPVTVIEAAPNVVLQKKTAENDGYEAIQL
GFDDKREKLSNKPEKGHVAKAETAPKRFVKELRGVEMDAYEVGQEVKVEI
FSAGEIVDVTGVSKGKGFQGAIKRHGQSRGPMSHGSRYHRRPGSMGPVDP
NRVFKGKLLPGRMGGEQITVQNLEIVKVDAERNLLLIKGNVPGAKKSLIT
VKSAVKS

3D structure

• PDB: 7aqd Mimicry of Canonical Translation Elongation Underlies Alanine Tail Synthesis in RQC.
• Chain: D
• Resolution: 3.1 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	D	M12 Q37 D44 Y46 Q50 R57 K59 L60 N62 K63 P64 G67 H68 R78 K81 E82 R84 S114 K115 G116 K117 G118 F119 Q120 G121 K124 R125 Q128 S129 R130 P132 S134 H135 G136 R138 Y139 H140 R141 R142 P143 S145 M146 G147 P148 V149 D150 P151 N152 R153 V154 K156 K158 L160 P161 R163 Q168 I169 T170 Q172 N173 N191 V192 P193 G194 A195 K197 S208	M11 Q36 D43 Y45 Q49 R56 K58 L59 N61 K62 P63 G66 H67 R77 K80 E81 R83 S113 K114 G115 K116 G117 F118 Q119 G120 K123 R124 Q127 S128 R129 P131 S133 H134 G135 R137 Y138 H139 R140 R141 P142 S144 M145 G146 P147 V148 D149 P150 N151 R152 V153 K155 K157 L159 P160 R162 Q167 I168 T169 Q171 N172 N190 V191 P192 G193 A194 K196 S207

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0006364 rRNA processing
• GO:0006412 translation
• GO:2000234 positive regulation of rRNA processing

Cellular Component

• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:7aqd, PDBe:7aqd, PDBj:7aqd
• PDBsum: 7aqd
• PubMed: 33259811
• UniProt: P42920|RL3_BACSU Large ribosomal subunit protein uL3 (Gene Name=rplC)