Structure of PDB 7aoa Chain D

Receptor sequence
>7aoaD (length=343) Species: 9606 (Homo sapiens) [Search protein sequence]
GDYVYFENSSSNPYLIRRIEELNKTANGNVEAKVVCFYRRRDISHQLRHR
ELFLSRQLESLPATHIRGKCSVTLLNETESLKSYLEREDFFFYSLVYDPQ
QKTLADGEIRVGNRYQADITDLLKEGEEDGRDQSRLETQVWEAHNPLTDK
QIDQFLVVARSVGTFARALDSLHMSAAAASRDITLFHAMDTLHKNIYDIS
KAISALVPQGGPVLCRDEMEEWSASEANLFEEALEKYGKDFTDIQQDFLP
WKSLTSIIEYYYMWKTTDRYVQQKRQAFYLHTTKLTRIARRLCREILRPW
HAARHPYLPINSAAIKAECTARLPEAVRKPLEAVLRYLETHPR
3D structure
PDB7aoa The topology of chromatin-binding domains in the NuRD deacetylase complex.
ChainD
Resolution19.4 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 IHP D K305 Y327 K331 K239 Y261 K265
Gene Ontology
Molecular Function
GO:0000978 RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0003677 DNA binding
GO:0003682 chromatin binding
GO:0003713 transcription coactivator activity
GO:0003714 transcription corepressor activity
GO:0005515 protein binding
GO:0042826 histone deacetylase binding
GO:0043565 sequence-specific DNA binding
GO:0046872 metal ion binding
GO:0061629 RNA polymerase II-specific DNA-binding transcription factor binding
Biological Process
GO:0000122 negative regulation of transcription by RNA polymerase II
GO:0006302 double-strand break repair
GO:0006338 chromatin remodeling
GO:0006355 regulation of DNA-templated transcription
GO:0007165 signal transduction
GO:0010212 response to ionizing radiation
GO:0032922 circadian regulation of gene expression
GO:0042659 regulation of cell fate specification
GO:0043153 entrainment of circadian clock by photoperiod
GO:0043161 proteasome-mediated ubiquitin-dependent protein catabolic process
GO:0045475 locomotor rhythm
GO:0045814 negative regulation of gene expression, epigenetic
GO:0045892 negative regulation of DNA-templated transcription
GO:0045893 positive regulation of DNA-templated transcription
GO:0048511 rhythmic process
GO:1902499 positive regulation of protein autoubiquitination
GO:2000736 regulation of stem cell differentiation
Cellular Component
GO:0005634 nucleus
GO:0005635 nuclear envelope
GO:0005654 nucleoplasm
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005856 cytoskeleton
GO:0005874 microtubule
GO:0016581 NuRD complex
GO:0043231 intracellular membrane-bounded organelle

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7aoa, PDBe:7aoa, PDBj:7aoa
PDBsum7aoa
PubMed33264408
UniProtQ13330|MTA1_HUMAN Metastasis-associated protein MTA1 (Gene Name=MTA1)

[Back to BioLiP]