Structure of PDB 7a0s Chain D

Receptor sequence

>7a0sD (length=177) Species: 243230 (Deinococcus radiodurans R1 = ATCC 13939 = DSM 20539)

QLKTKYNDQVRPALMQQFGYSSVMAVPRIEKIVVNEGLGSSKEDSKAIDK
AAKELALITLQKPIITKAKKSISNFKLRQGMPVGIKVTLRGERMYVFLEK
LINIGLPRIRDFRGINPNAFDGRGNYNLGIKEQLIFPEITYDMVDKTRGM
DITIVTTAKTDEEARALLQSMGLPFRK

3D structure

• PDB: 7a0s Ribosome-binding and anti-microbial studies of the mycinamicins, 16-membered macrolide antibiotics from Micromonospora griseorubida.
• Chain: D
• Resolution: 3.22 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	D	N37 G39 G41 S42 T68 K71 K72 N76 F77 V85 K88 F122 R125 N129 I132 K133 G151 M152 D153 T155	N35 G37 G39 S40 T66 K69 K70 N74 F75 V83 K86 F120 R123 N127 I130 K131 G149 M150 D151 T153
BS02	rna	D	S24 M26 A27 R30 Q63 K64 I66 K69 T90 R92	S22 M24 A25 R28 Q61 K62 I64 K67 T88 R90

Gene Ontology

Molecular Function

• GO:0000049 tRNA binding
• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:7a0s, PDBe:7a0s, PDBj:7a0s
• PDBsum: 7a0s
• PubMed: 34417608
• UniProt: Q9RXJ0|RL5_DEIRA Large ribosomal subunit protein uL5 (Gene Name=rplE)