Structure of PDB 7a0r Chain D

Receptor sequence
>7a0rD (length=177) Species: 243230 (Deinococcus radiodurans R1 = ATCC 13939 = DSM 20539) [Search protein sequence]
QLKTKYNDQVRPALMQQFGYSSVMAVPRIEKIVVNEGLGSSKEDSKAIDK
AAKELALITLQKPIITKAKKSISNFKLRQGMPVGIKVTLRGERMYVFLEK
LINIGLPRIRDFRGINPNAFDGRGNYNLGIKEQLIFPEITYDMVDKTRGM
DITIVTTAKTDEEARALLQSMGLPFRK
3D structure
PDB7a0r Ribosome-binding and anti-microbial studies of the mycinamicins, 16-membered macrolide antibiotics from Micromonospora griseorubida.
ChainD
Resolution3.3 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna D V35 N37 S42 S43 T68 K71 F77 V85 K88 F122 G131 I132 K133 R150 G151 M152 D153 T155 V33 N35 S40 S41 T66 K69 F75 V83 K86 F120 G129 I130 K131 R148 G149 M150 D151 T153
BS02 rna D S24 M26 A27 K64 I66 K69 K88 V89 T90 R92 S22 M24 A25 K62 I64 K67 K86 V87 T88 R90
Gene Ontology
Molecular Function
GO:0000049 tRNA binding
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7a0r, PDBe:7a0r, PDBj:7a0r
PDBsum7a0r
PubMed34417608
UniProtQ9RXJ0|RL5_DEIRA Large ribosomal subunit protein uL5 (Gene Name=rplE)

[Back to BioLiP]