Structure of PDB 6zyz Chain D

Receptor sequence
>6zyzD (length=259) Species: 39367 (Salvia rosmarinus) [Search protein sequence]
RRLEGKVAIVTGGASGIGASTVRLFHDHGAKVVIADIQDDLGQTLADRLG
RNISYTHCDVTDEDQVRALVDAAVAKHGGVDIMFSNAGIVEGPNSIFDVD
KDELERLMGINLVGAFLAAKHAARVMVPAKKGCIIFTASACTEIAGIAGH
SYTASKYGIVGLMKSLAVELGSHGIRANCVSPFGVLTGIVPDDEASKLMF
EGIMSKVGNLKGKILTAEDVAVTVLYLASEEASYVSGVNLLVDGGYTVVN
PTFINVITA
3D structure
PDB6zyz A Structural View on the Stereospecificity of Plant Borneol-Type Dehydrogenases.
ChainD
Resolution2.27 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 NAD D G19 S22 G23 I24 D43 I44 Q45 C65 D66 V67 N93 A94 G95 V97 T144 Y159 K163 P189 G191 V192 T194 G12 S15 G16 I17 D36 I37 Q38 C58 D59 V60 N86 A87 G88 V90 T137 Y152 K156 P182 G184 V185 T187
Gene Ontology
--> -->
 
 
UnboundLocalError		Python 3.6.8: /usr/bin/python3
Fri Nov 15 09:46:03 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)
   1444         else:
=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)
   1446     
   1447     uniprot_line=''
pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '6zyz', asym_id = 'D', title = 'A Structural View on the Stereospecificity of Plant Borneol-Type Dehydrogenases.'
 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='6zyz', asym_id='D', title='A Structural View on the Stereospecificity of Plant Borneol-Type Dehydrogenases.')
    839 
    840     if go:
=>  841         display_go(go,uniprot,pdbid,asym_id)
    842     return pubmed,uniprot
    843 
global display_go = <function display_go>, go = '0016491', uniprot = '', pdbid = '6zyz', asym_id = 'D'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0016491', uniprot='', pdbid='6zyz', asym_id='D')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>