Structure of PDB 6zn5 Chain D

Receptor sequence

>6zn5D (length=218) Species: 9606 (Homo sapiens) [Search protein sequence]

EWMPVTKLGRLVKDMKIKSLEEIYLFSLPIKESEIIDFFLGASLKDEVLK
IMPVQKQTRAGQRTRFKAFVAIGDYNGHVGLGVKCSKEVATAIRGAIILA
KLSIVPVRRGYWGNKIGKPHTVPCKVTGRCGSVLVRLIPAPRGTGIVSAP
VPKKLLMMAGIDDCYTSARGCTATLGNFAKATFDAISKTYSYLTPDLWKE
TVFTKSPYQEFTDHLVKT

3D structure

PDB

6zn5 Structural basis for translational shutdown and immune evasion by the Nsp1 protein of SARS-CoV-2.

Chain

Resolution

3.2 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	D	V112 Q113 K114 Q115 T116 R117 R121 R123 K145 T185 R187 G189 S190 L192 R194 V205 S206 Y223 T224 A226 C229 T232 N235 K238	V54 Q55 K56 Q57 T58 R59 R63 R65 K87 T127 R129 G131 S132 L134 R136 V147 S148 Y165 T166 A168 C171 T174 N177 K180
BS02	peptide	D	I109 P111 Q113 T122 E146 V147 I151	I51 P53 Q55 T64 E88 V89 I93

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0015935	small ribosomal subunit

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:6zn5, PDBe:6zn5, PDBj:6zn5
PDBsum	6zn5
PubMed	32680882
UniProt	P15880\|RS2_HUMAN Small ribosomal subunit protein uS5 (Gene Name=RPS2)

[Back to BioLiP]