Structure of PDB 6z5r Chain D

Receptor sequence
>6z5rD (length=49) Species: 258594 (Rhodopseudomonas palustris CGA009) [Search protein sequence]
GSISGLSEAEAKEFHSIFVTSFFLFIVVAVVAHILAWMWRPWLPKATGY
3D structure
PDB6z5r Structures of Rhodopseudomonas palustris RC-LH1 complexes with open or closed quinone channels.
ChainD
Resolution2.8 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 BCL D F28 I29 A32 H36 W45 F25 I26 A29 H33 W42
BS02 CRT D F17 I20 F21 S24 F25 F14 I17 F18 S21 F22
Gene Ontology
Molecular Function
GO:0045156 electron transporter, transferring electrons within the cyclic electron transport pathway of photosynthesis activity
Biological Process
GO:0019684 photosynthesis, light reaction
Cellular Component
GO:0016020 membrane
GO:0030077 plasma membrane light-harvesting complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6z5r, PDBe:6z5r, PDBj:6z5r
PDBsum6z5r
PubMed33523887
UniProtQ6N9L5

[Back to BioLiP]