Structure of PDB 6z48 Chain D

Receptor sequence

>6z48D (length=254) Species: 9606 (Homo sapiens)

IVEGSDAEIGMSPWQVMLFRKSPQELLCGASLISDRWVLTAAHCLLYPPW
DKNFTENDLLVRIGKHSRTRYERNIEKISMLEKIYIHPRYNWRENLDRDI
ALMKLKKPVAFSDYIHPVCLPDRETAASLLQAGYKGRVTGWGNLKETVGK
GQPSVLQVVNLPIVERPVCKDSTRIRITDNMFCAGYKPDEGKRGDACEGD
SGGPFVMKSPFNNRWYQMGIVSWGEGCDRDGKYGFYTHVFRLKKWIQKVI
DQFG

3D structure

• PDB: 6z48 Synthesis and direct assay of large macrocycle diversities by combinatorial late-stage modification at picomole scale.
• Chain: D
• Resolution: 2.27 Å

Enzymatic activity

• Enzyme Commision number: 3.4.21.5: thrombin.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	D	S72 R75 E77 S153	S67 R70 E72 S154
BS02	peptide	D	E23 G25 M26 W29 D116 H119 P120 C122 L129C Y134 K135 G136 R137 N159 K202 R206 W207	E8 G10 M11 W14 D113 H116 P117 C119 L129 Y134 K135 G136 R137 N160 K208 R214 W215
BS03	X1V	D	H57 Y60A W60D N98 L99 I174 D189 A190 C191 E192 V213 S214 W215 G216 E217 G219 G226 F227 Y228	H43 Y47 W50 N95 L96 I175 D195 A196 C197 E198 V221 S222 W223 G224 E225 G226 G234 F235 Y236

Gene Ontology

Molecular Function

• GO:0004252 serine-type endopeptidase activity
• GO:0005509 calcium ion binding

Biological Process

• GO:0006508 proteolysis
• GO:0007596 blood coagulation

External links

• PDB: RCSB:6z48, PDBe:6z48, PDBj:6z48
• PDBsum: 6z48
• PubMed: 35780129
• UniProt: P00734|THRB_HUMAN Prothrombin (Gene Name=F2)