Structure of PDB 6ywv Chain D

Receptor sequence

>6ywvD (length=254) Species: 367110 (Neurospora crassa OR74A) [Search protein sequence]

ITNVPVTVYSFPELEPRSLESYSARHLHLPLRRDILHLAVIYEGDSTRRG
MASTKTRYEVHGSHKKMSPQKGTGNARRGTRQSPLMKGGGKTFGPKPRDF
STKLNKKVYDLAWRTALSYRYKRGELIVTEDGLDLPLPNDFLWLAGGGKL
SRELEDGYVRKWVHEFMTSLNWGKEAGRTTFITGDKRPNLFTGFELAGAE
GRALELWDVDVKDLLETGRIVIERSALKEMIEDHQSDLVTRGPNLGEVLV
RAPR

3D structure

PDB

6ywv Analysis of translating mitoribosome reveals functional characteristics of translation in mitochondria of fungi.

Chain

Resolution

3.03 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	D	R93 R94 H98 I102 G105 R109 R110 M112 A113 K116 R118 Y119 V121 H122 S124 H125 K126 K127 Q131 K132 G133 G135 N136 A137 R138 G140 R142 L146 K148 K152 F154 P156 P158 R159 T163 K164 N166 K168 V169 G259 K273 E277	R32 R33 H37 I41 G44 R48 R49 M51 A52 K55 R57 Y58 V60 H61 S63 H64 K65 K66 Q70 K71 G72 G74 N75 A76 R77 G79 R81 L85 K87 K91 F93 P95 P97 R98 T102 K103 N105 K107 V108 G198 K212 E216

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005739	mitochondrion
GO:0005840	ribosome
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:6ywv, PDBe:6ywv, PDBj:6ywv
PDBsum	6ywv
PubMed	33056988
UniProt	V5IMN1\|RL4P_NEUCR Large ribosomal subunit protein uL4m (Gene Name=yml6)

[Back to BioLiP]