Structure of PDB 6xwg Chain D

Receptor sequence
>6xwgD (length=80) Species: 9606 (Homo sapiens) [Search protein sequence]
PRIYKPCFVCQDKSSGYHYGVSACEGCKGFFRRSIQKNMVYTCHRDKNCI
INKVTRNRCQYCRLQKCFEVGMSKESVRND
3D structure
PDB6xwg Structural basis for DNA recognition and allosteric control of the retinoic acid receptors RAR-RXR.
ChainD
Resolution2.4 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna D R83 H99 Y100 K109 R113 V158 R159 R2 H18 Y19 K28 R32 V77 R78
BS02 dna D E106 G107 R114 R137 N138 Q141 R144 E25 G26 R33 R56 N57 Q60 R63
BS03 ZN D C88 C91 C105 C108 C7 C10 C24 C27
BS04 ZN D C130 C140 C143 C49 C59 C62
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
GO:0008270 zinc ion binding
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:6xwg, PDBe:6xwg, PDBj:6xwg
PDBsum6xwg
PubMed32974652
UniProtP10276|RARA_HUMAN Retinoic acid receptor alpha (Gene Name=RARA)

[Back to BioLiP]