Structure of PDB 6x1o Chain D

Receptor sequence

>6x1oD (length=166) Species: 1185654 (Pyrococcus furiosus COM1) [Search protein sequence]

AIWILITPDKCSGCRLCEVTCSLEHEGIIWPEASRIRVFELFPGINVPHT
CVQCPDYPCVNACPTNALSVDEKTGAVVVNEEKCITCGACVLACPGKVPR
IPAGKGSVVICDLCGGNPKCVEICHEAGHDALKIVTGNYRPIYRTFAKDP
QEKSLDIARKVFGEDF

3D structure

PDB

6x1o An unprecedented function for a tungsten-containing oxidoreductase.

Chain

Resolution

2.094 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	SF4	D	C18 S19 C21 R22 C24 V45 C131 H136 L139	C11 S12 C14 R15 C17 V38 C124 H129 L132
BS02	SF4	D	C58 V59 C61 P65 C66 C101 P106	C51 V52 C54 P58 C59 C94 P99
BS03	SF4	D	C70 P71 L75 C91 I92 T93 C94 G95 C97	C63 P64 L68 C84 I85 T86 C87 G88 C90
BS04	SF4	D	C28 H32 R42 I43 C118 D119 L120 C121 P125 C127	C21 H25 R35 I36 C111 D112 L113 C114 P118 C120

Gene Ontology

	Molecular Function
GO:0016491	oxidoreductase activity
GO:0046872	metal ion binding
GO:0051539	4 iron, 4 sulfur cluster binding

View graph for
Molecular Function

External links

PDB	RCSB:6x1o, PDBe:6x1o, PDBj:6x1o
PDBsum	6x1o
PubMed	36269456
UniProt	I6U881

[Back to BioLiP]