Structure of PDB 6wu9 Chain D

Receptor sequence

>6wu9D (length=207) Species: 474186 (Enterococcus faecalis OG1RF) [Search protein sequence]

TKGILGKKVGMTQIFTESGELIPVTVVEATPNVVLQVKTVETDGYEAIQV
GYQDKREVLSNKPAKGHVAKANTAPKRFIKEFKNVELGEYEVGKEIKVDV
FQAGDVVDVTGTTKGKGFQGAIKRHGQSRGPMSHGSRYHRRPGSMGPVAP
NRVFKNKRLAGRMGGDRVTIQNLEVVKVDVERNVILIKGNIPGAKKSLIT
IKSAVKA

3D structure

PDB

6wu9 Cryo-electron microscopy structure of the 70S ribosome from Enterococcus faecalis.

Chain

Resolution

2.9 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	D	M12 Q14 P24 Q37 D44 Y46 R57 V59 N62 K63 P64 G67 H68 R78 E82 T114 K115 G116 K117 G118 F119 G121 K124 R125 Q128 S129 R130 S134 H135 G136 Y139 H140 R141 S145 M146 P148 V149 A150 P151 N152 R153 V154 F155 K158 L160 R163 R168 T170 Q172 N173 N191 I192 P193 K207	M11 Q13 P23 Q36 D43 Y45 R56 V58 N61 K62 P63 G66 H67 R77 E81 T113 K114 G115 K116 G117 F118 G120 K123 R124 Q127 S128 R129 S133 H134 G135 Y138 H139 R140 S144 M145 P147 V148 A149 P150 N151 R152 V153 F154 K157 L159 R162 R167 T169 Q171 N172 N190 I191 P192 K206

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:6wu9, PDBe:6wu9, PDBj:6wu9
PDBsum	6wu9
PubMed	33004869
UniProt	Q839G4\|RL3_ENTFA Large ribosomal subunit protein uL3 (Gene Name=rplC)

[Back to BioLiP]