Structure of PDB 6w8b Chain D

Receptor sequence

>6w8bD (length=285) Species: 9606 (Homo sapiens)

AEKRKPIRVLSLFDGIATGLLVLKDLGIQVDRYIASEVCEDSITVGMVRH
QGKIMYVGDVRSVTQKHIQEWGPFDLVIGGSPCNDLSIVNPARKGLYEGT
GRLFFEFYRLLHDARPKEGDDRPFFWLFENVVAMGVSDKRDISRFLESNP
VMIDAKEVSAAHRARYFWGNLPGMNRPLASTVNDKLELQECLEHGRIAKF
SKVRTITTRSNSIKQGKDQHFPVFMNEKEDILWCTEMERVFGFPVHYTDV
SNMSRLARQRLLGRSWSVPVIRHLFAPLKEYFACV

3D structure

• PDB: 6w8b Structural basis for impairment of DNA methylation by the DNMT3A R882H mutation.
• Chain: D
• Resolution: 2.4 Å

Enzymatic activity

• Enzyme Commision number: 2.1.1.-
  2.1.1.37: DNA (cytosine-5-)-methyltransferase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	dna	D	S708 C710 N711 S714 V716 N717 E756 V758 R792 R831 T832 T834 T835 R836 G890 R891	S81 C83 N84 S87 V89 N90 E129 V131 R165 R204 T205 T207 T208 R209 G263 R264
BS02	dna	D	I715 V716 P718 R720 V763 N838 S881 L883	I88 V89 P91 R93 V136 N211 S254 L256
BS03	SAH	D	F640 D641 G642 I643 T645 E664 V665 D686 V687 G707 R891 S892 W893	F13 D14 G15 I16 T18 E37 V38 D59 V60 G80 R264 S265 W266

Gene Ontology

Molecular Function

• GO:0008168 methyltransferase activity

External links

• PDB: RCSB:6w8b, PDBe:6w8b, PDBj:6w8b
• PDBsum: 6w8b
• PubMed: 32385248
• UniProt: Q9Y6K1|DNM3A_HUMAN DNA (cytosine-5)-methyltransferase 3A (Gene Name=DNMT3A)