Structure of PDB 6vly Chain D

Receptor sequence

>6vlyD (length=284) Species: 214856 (Alistipes finegoldii)

YNLLKGKKGLIFGALNEQSIAWKVAERAVEEGAEIVLTNTAVSIRMGTIG
RLAEKCNTIVVPADATSVEDLENLIDKTMEHFGGKFDFMLHSIGMSPNVR
KGRTYDDLDYDYLSKTLDISAISFHKAIQVARKKDAINDWGSIVALSYIA
AQRTLYGYNDMADAKALLESIARSFGYIYGREKHVRINTVSQSPTPTTAG
SGVLGMGDLMNFAENMSPLGNASANDCADYVLTLFSDLTRKVTMQNLYHD
GGFASMGMSRRAMKTYEKGMRFEDVHQNQYPFGE

3D structure

• PDB: 6vly The genome of a Bacteroidetes inhabitant of the human gut encodes a structurally distinct enoyl-acyl carrier protein reductase (FabI).
• Chain: D
• Resolution: 1.86 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	NAI	D	G15 S21 I22 N41 T42 S45 A67 S94 I95 I121 S149 K167 Q194 P196 T197 T199 A201	G13 S19 I20 N39 T40 S43 A65 S92 I93 I119 S147 K165 Q192 P194 T195 T197 A199	MOAD: Kd=225nM

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Thu Nov 28 22:48:57 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)

   1444         else:

=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)

   1446     

   1447     uniprot_line=''

pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '6vly', asym_id = 'D', title = 'The genome of a Bacteroidetes inhabitant of the ...nct enoyl-acyl carrier protein reductase (FabI). '

 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='6vly', asym_id='D', title='The genome of a Bacteroidetes inhabitant of the ...nct enoyl-acyl carrier protein reductase (FabI). ')

    839 

    840     if go:

=>  841         display_go(go,uniprot,pdbid,asym_id)

    842     return pubmed,uniprot

    843 

global display_go = <function display_go>, go = '0004318,0006633', uniprot = '', pdbid = '6vly', asym_id = 'D'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0004318,0006633', uniprot='', pdbid='6vly', asym_id='D')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>