Structure of PDB 6v92 Chain D |
>6v92D (length=100) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence] |
MGYYDVLAGLSALEKSSQVVFSATELQQLTQKRVAVHGYLGGKVSLADAA QVEYEVGHSLLGSYVPRQQLEALSSVDFSHHFHRTLECKAALETHDVFLA |
|
PDB | 6v92 Architecture of the chromatin remodeler RSC and insights into its nucleosome engagement. |
Chain | D |
Resolution | 20.0 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
peptide |
D |
S90 Y91 |
S63 Y64 |
|
|
|
|