Structure of PDB 6v3k Chain D

Receptor sequence

>6v3kD (length=47) Species: 11698,273057

NFRVYYRDSRDPVWKGPAKLLWKGEGAVVIQDNSDIKVVPRRKAKII

3D structure

• PDB: 6v3k Structural basis for strand-transfer inhibitor binding to HIV intasomes.
• Chain: D
• Resolution: 3.4 Å

Enzymatic activity

• Enzyme Commision number:
  2.7.7.-
  2.7.7.49: RNA-directed DNA polymerase.
  2.7.7.7: DNA-directed DNA polymerase.
  3.1.-.-
  3.1.13.2: exoribonuclease H.
  3.1.26.13: retroviral ribonuclease H.
  3.4.23.16: HIV-1 retropepsin.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	dna	D	W243 E246 G247 R263	W22 E25 G26 R42

Gene Ontology

Molecular Function

• GO:0003676 nucleic acid binding
• GO:0003677 DNA binding
• GO:0004521 RNA endonuclease activity
• GO:0008270 zinc ion binding

Biological Process

• GO:0015074 DNA integration

Cellular Component

• GO:0005737 cytoplasm

External links

• PDB: RCSB:6v3k, PDBe:6v3k, PDBj:6v3k
• PDBsum: 6v3k
• PubMed: 32001521
• UniProt: P12497|POL_HV1N5 Gag-Pol polyprotein (Gene Name=gag-pol);
  P39476|DN7D_SACS2 DNA-binding protein 7d (Gene Name=sso7d)