Structure of PDB 6uyk Chain D

Receptor sequence

>6uykD (length=249) Species: 1063 (Cereibacter sphaeroides)

GAKVFAVYGKGGIGKSTTSSNLSAAFSILGKRVLQIGCDPKHDSTFTLTG
SLVPTVIDVLKDVDFHPEELRPEDFVFEGFNGVMCVEAGGPPAGTGCGGY
VVGQTVKLLKQHHLLDDTDVVIFDVLGDVVCGGFAAPLQHADQAVVVTAN
DFDSIYAMNRIIAAVQAKSKNYKVRLAGCVANRDEVDRFCKETNFRRLAH
RLKKKTLFEMDEDQDVLAARAEYIRLAESLWRGLDPIDPHSLPDREIFE

3D structure

• PDB: 6uyk The flexible N-terminus of BchL autoinhibits activity through interaction with its [4Fe-4S] cluster and released upon ATP binding.
• Chain: D
• Resolution: 2.6 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): K39 K44 K70 D157
• Catalytic site (residue number reindexed from 1): K10 K15 K41 D128
• Enzyme Commision number: 1.3.7.7: ferredoxin:protochlorophyllide reductase (ATP-dependent).

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	SF4	D	C126 G127 C160 G162 F163	C97 G98 C131 G133 F134

Gene Ontology

Molecular Function

• GO:0005524 ATP binding
• GO:0016491 oxidoreductase activity
• GO:0016636 oxidoreductase activity, acting on the CH-CH group of donors, iron-sulfur protein as acceptor
• GO:0016730 oxidoreductase activity, acting on iron-sulfur proteins as donors
• GO:0046872 metal ion binding
• GO:0051539 4 iron, 4 sulfur cluster binding

Biological Process

• GO:0015979 photosynthesis
• GO:0015995 chlorophyll biosynthetic process
• GO:0019685 photosynthesis, dark reaction
• GO:0030494 bacteriochlorophyll biosynthetic process
• GO:0036070 light-independent bacteriochlorophyll biosynthetic process

External links

• PDB: RCSB:6uyk, PDBe:6uyk, PDBj:6uyk
• PDBsum: 6uyk
• PubMed: 33219127
• UniProt: Q9RFD6|BCHL_CERS4 Light-independent protochlorophyllide reductase iron-sulfur ATP-binding protein (Gene Name=bchL)