Structure of PDB 6t83 Chain D

Receptor sequence

>6t83D (length=172) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]

MAHFKEYQVIGRRLPTESVPEPKLFRMRIFASNEVIAKSRYWYFLQKLHK
VKKASGEIVSINQINEAHPTKVKNFGVWVRYDSRSGTHNMYKEIRDVSRV
AAVETLYQDMAARHRARFRSIHILKVAEIEKTADVKRQYVKQFLTKDLKF
PLPHRVQKSTKTFSYKRPSTFY

3D structure

PDB

6t83 Molecular mechanism of translational stalling by inhibitory codon combinations and poly(A) tracts.

Chain

Resolution

4.0 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	D	M1 A2 N65 H68 K71 S83 R84 H88 Y91 K92 Q108 A111 A112 R113 H114 R115 R117 T132 R137 L144 K146 H154 R155 K158 Y165 S169 T170 F171	M1 A2 N65 H68 K71 S83 R84 H88 Y91 K92 Q108 A111 A112 R113 H114 R115 R117 T132 R137 L144 K146 H154 R155 K158 Y165 S169 T170 F171
BS02	rna	D	R13 Y43 Q46 K47 H49 K50 V51 K52 K53 R84 R119	R13 Y43 Q46 K47 H49 K50 V51 K52 K53 R84 R119

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0002181	cytoplasmic translation
GO:0006412	translation

	Cellular Component
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:6t83, PDBe:6t83, PDBj:6t83
PDBsum	6t83
PubMed	31858614
UniProt	P0CX23\|RL20A_YEAST Large ribosomal subunit protein eL20A (Gene Name=RPL20A)

[Back to BioLiP]