Structure of PDB 6syf Chain D

Receptor sequence
>6syfD (length=153) Species: 9606 (Homo sapiens) [Search protein sequence]
ALSRLAQERKAWRKDHPFGFVAVPTKNPDGTMNLMNWECAIPGAAGTPWA
GGLFKLRMLFKDDYPSSPPKCKFEPPLFHPNVYPSGTVCLSILEEDKDWR
PAITIKQILLGIQELLNEPNIQDPAQAEAYTIYAQNRVEYEKRVRAQAKK
FAP
3D structure
PDB6syf Lysine acylation using conjugating enzymes for site-specific modification and ubiquitination of recombinant proteins.
ChainD
Resolution1.9 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number 2.3.2.-
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 peptide D N85 C93 L94 S95 I96 D102 G115 E118 L119 N124 D127 N81 C89 L90 S91 I92 D98 G111 E114 L115 N120 D123
BS02 peptide D Y87 S89 T91 C93 P128 A129 Y83 S85 T87 C89 P124 A125
Gene Ontology
Molecular Function
GO:0001221 transcription coregulator binding
GO:0003723 RNA binding
GO:0005515 protein binding
GO:0005524 ATP binding
GO:0008134 transcription factor binding
GO:0016740 transferase activity
GO:0019787 ubiquitin-like protein transferase activity
GO:0019789 SUMO transferase activity
GO:0019899 enzyme binding
GO:0044388 small protein activating enzyme binding
GO:0061656 SUMO conjugating enzyme activity
GO:0071535 RING-like zinc finger domain binding
Biological Process
GO:0000122 negative regulation of transcription by RNA polymerase II
GO:0006511 ubiquitin-dependent protein catabolic process
GO:0007059 chromosome segregation
GO:0007084 mitotic nuclear membrane reassembly
GO:0016925 protein sumoylation
GO:0030335 positive regulation of cell migration
GO:0032446 protein modification by small protein conjugation
GO:0036211 protein modification process
GO:0045892 negative regulation of DNA-templated transcription
GO:0051168 nuclear export
GO:0051301 cell division
GO:1903755 positive regulation of SUMO transferase activity
Cellular Component
GO:0000795 synaptonemal complex
GO:0005634 nucleus
GO:0005635 nuclear envelope
GO:0005643 nuclear pore
GO:0005654 nucleoplasm
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0016605 PML body
GO:0048471 perinuclear region of cytoplasm
GO:0106068 SUMO ligase complex
GO:1990234 transferase complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6syf, PDBe:6syf, PDBj:6syf
PDBsum6syf
PubMed32929246
UniProtP63279|UBC9_HUMAN SUMO-conjugating enzyme UBC9 (Gene Name=UBE2I)

[Back to BioLiP]