Structure of PDB 6sqz Chain D

Receptor sequence
>6sqzD (length=110) Species: 10090 (Mus musculus) [Search protein sequence]
PFRFSPEPTLEDIRRLHAEFAAERDWEQFHQPRNLLLALVGEVGELAELF
QWKSDTEPGPQAWPPKERAALQEELSDVLIYLVALAARCHVDLPQAVISK
MDTNRQRYPV
3D structure
PDB6sqz The First Structure of an Active Mammalian dCTPase and its Complexes With Substrate Analogs and Products.
ChainD
Resolution1.9 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number 3.6.1.12: dCTP diphosphatase.
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 MG D E63 E66 E95 D98 E42 E45 E74 D77
BS02 MG D E63 E66 E42 E45
BS03 0KX D W47 E63 E66 D98 Y102 W26 E42 E45 D77 Y81
Gene Ontology
Molecular Function
GO:0000166 nucleotide binding
GO:0000287 magnesium ion binding
GO:0016462 pyrophosphatase activity
GO:0016787 hydrolase activity
GO:0032556 pyrimidine deoxyribonucleotide binding
GO:0042802 identical protein binding
GO:0046872 metal ion binding
GO:0047429 nucleoside triphosphate diphosphatase activity
GO:0047840 dCTP diphosphatase activity
Biological Process
GO:0006253 dCTP catabolic process
GO:0009143 nucleoside triphosphate catabolic process
GO:0042262 DNA protection
Cellular Component
GO:0005634 nucleus
GO:0005737 cytoplasm
GO:0005739 mitochondrion
GO:0005829 cytosol

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6sqz, PDBe:6sqz, PDBj:6sqz
PDBsum6sqz
PubMed31954130
UniProtQ9QY93|DCTP1_MOUSE dCTP pyrophosphatase 1 (Gene Name=Dctpp1)

[Back to BioLiP]