Structure of PDB 6snt Chain D

Receptor sequence
>6sntD (length=222) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]
LISKKRKLVADGVFYAELNEFFTRELAEEGYSGVEVRVTPTKTEVIIRAT
RTQDVLGENGRRINELTLLVQKRFKYAPGTIVLYAERVQDRGLSAVAQAE
SMKFKLLNGLAIRRAAYGVVRYVMESGAKGCEVVVSGKLRAARAKAMKFA
DGFLIHSGQPVNDFIDTATRHVLMRQGVLGIKVKIMRDPAKSRTGPKALP
DAVTIIEPKEEEPILAPSVKDY
3D structure
PDB6snt RQT complex dissociates ribosomes collided on endogenous RQC substrate SDD1.
ChainD
Resolution2.8 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna D L4 I5 S6 K7 K8 R9 R27 K141 R143 A145 R146 A147 K151 L157 I158 H159 S160 G161 Q162 Q179 V181 G183 K185 D204 L1 I2 S3 K4 K5 R6 R24 K138 R140 A142 R143 A144 K148 L154 I155 H156 S157 G158 Q159 Q176 V178 G180 K182 D201
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0003906 DNA-(apurinic or apyrimidinic site) endonuclease activity
GO:0005515 protein binding
Biological Process
GO:0000054 ribosomal subunit export from nucleus
GO:0000056 ribosomal small subunit export from nucleus
GO:0002181 cytoplasmic translation
GO:0006412 translation
GO:0070651 nonfunctional rRNA decay
GO:1990145 maintenance of translational fidelity
Cellular Component
GO:0005634 nucleus
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0015935 small ribosomal subunit
GO:0022626 cytosolic ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:0030686 90S preribosome
GO:0030688 preribosome, small subunit precursor
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6snt, PDBe:6snt, PDBj:6snt
PDBsum6snt
PubMed32203490
UniProtP05750|RS3_YEAST Small ribosomal subunit protein uS3 (Gene Name=RPS3)

[Back to BioLiP]