Structure of PDB 6s7o Chain D

Receptor sequence
>6s7oD (length=110) Species: 9606 (Homo sapiens) [Search protein sequence]
SVVSVISRFLEEYLSSTPQRLKLLDAYLLYILLTGALQFGYCLLVGTFPF
NSFLSGFISCVGSFILAVCLRIQINPQNKADFQGISPERAFADFLFASTI
LHLVVMNFVG
3D structure
PDB6s7o Cryo-electron microscopy structures of human oligosaccharyltransferase complexes OST-A and OST-B.
ChainD
Resolution3.5 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 KZB D F42 F56 I61 F39 F53 I58
BS02 EGY D R92 A95 F99 R89 A92 F96
Gene Ontology
Molecular Function
GO:0008047 enzyme activator activity
Biological Process
GO:0001824 blastocyst development
GO:0006486 protein glycosylation
GO:0006487 protein N-linked glycosylation
GO:0006915 apoptotic process
GO:0018279 protein N-linked glycosylation via asparagine
GO:0031647 regulation of protein stability
GO:0043066 negative regulation of apoptotic process
Cellular Component
GO:0005783 endoplasmic reticulum
GO:0005789 endoplasmic reticulum membrane
GO:0008250 oligosaccharyltransferase complex
GO:0016020 membrane

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6s7o, PDBe:6s7o, PDBj:6s7o
PDBsum6s7o
PubMed31831667
UniProtP61803|DAD1_HUMAN Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1 (Gene Name=DAD1)

[Back to BioLiP]