Structure of PDB 6rke Chain D

Receptor sequence

>6rkeD (length=268) Species: 322710 (Azotobacter vinelandii DJ) [Search protein sequence]

NSTAELEELLMQRSLTDPQLQAAAAAAADFRILPDATVIKIGGQSVIDRG
RAAVYPLVDEIVAARKNHKLLIGTGAGTRARHLYSIAAGLGLPAGVLAQL
GSSVADQNAAMLGQLLAKHGIPVVGGAGLSAVPLSLAEVNAVVFSGMPPY
KLWMRPAAEGVIPPYRTDAGCFLLAEQFGCKQMIFVKDEDGLYTANPKTS
KDATFIPRISVDEMKAKGLHDSILEFPVLDLLQSAQHVREVQVVNGLVPG
NLTRALAGEHVGTIITAS

3D structure

PDB

6rke Molybdate pumping into the molybdenum storage protein via an ATP-powered piercing mechanism.

Chain

Resolution

1.7 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	LJB	D	P124 V126 S132 V134 P135	P122 V124 S130 V132 P133
BS02	ADP	D	G45 Q46 S47 K189 D190 L194 Y195 A197 N198 P199 K200 D223 S224 I225	G43 Q44 S45 K187 D188 L192 Y193 A195 N196 P197 K198 D221 S222 I223
BS03	MOO	D	A78 G79 R83 Y86 R168 T169	A76 G77 R81 Y84 R166 T167
BS04	PO4	D	G77 A78 G79 R83 T169	G75 A76 G77 R81 T167
BS05	8M0	D	G127 G128 F146 P151 L176 F180	G125 G126 F144 P149 L174 F178

Gene Ontology

	Molecular Function
GO:0030151	molybdenum ion binding
GO:0045735	nutrient reservoir activity
GO:0046872	metal ion binding

	Cellular Component
GO:0005737	cytoplasm

View graph for
Molecular Function

View graph for
Cellular Component

External links

PDB	RCSB:6rke, PDBe:6rke, PDBj:6rke
PDBsum	6rke
PubMed	31811022
UniProt	P84253\|MOSB_AZOVD Molybdenum storage protein subunit beta (Gene Name=mosB)

[Back to BioLiP]