Structure of PDB 6rgy Chain D |
>6rgyD (length=121) Species: 243274 (Thermotoga maritima MSB8) [Search protein sequence] |
SKKVLLVDDSAVLRKIVSFNLKKEGYEVIEAENGQIALEKLSEFTPDLIV LDIMMPVMDGFTVLKKLQEKEEWKRIPVIVLTAKGGEEDESLALSLGARK VMRKPFSPSQFIEEVKHLLNE |
|
PDB | 6rgy Revisiting the pH-gated conformational switch on the activities of HisKA-family histidine kinases. |
Chain | D |
Resolution | 2.2 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
MG |
D |
D10 X53 M55 |
D9 X52 M54 |
|
|
|
|