Structure of PDB 6q8u Chain D

Receptor sequence
>6q8uD (length=122) Species: 224325 (Archaeoglobus fulgidus DSM 4304) [Search protein sequence]
GPEASYVRFEVPEDMQNEALSLLEKVRESGKVKKGTNETTKAVERGLAKL
VYIAEDVDPPEIVAHLPLLCEEKNVPYIYVKSKNDLGRAVGIEVPCASAA
IINEGELRKELGSLVEKIKGLQ
3D structure
PDB6q8u Effect of methylation of adenine N6on kink turn structure depends on location.
ChainD
Resolution1.99 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna D K30 G31 T32 N33 E34 D54 P55 I58 K79 I88 V90 P91 C92 A93 K34 G35 T36 N37 E38 D58 P59 I62 K83 I92 V94 P95 C96 A97
BS02 rna D N33 E34 K37 R41 N37 E38 K41 R45
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0004526 ribonuclease P activity
GO:0019843 rRNA binding
Biological Process
GO:0001682 tRNA 5'-leader removal
GO:0006412 translation
GO:0008033 tRNA processing
GO:0042254 ribosome biogenesis
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6q8u, PDBe:6q8u, PDBj:6q8u
PDBsum6q8u
PubMed31234702
UniProtO29494|RL7A_ARCFU Large ribosomal subunit protein eL8 (Gene Name=rpl7ae)

[Back to BioLiP]