Structure of PDB 6ppf Chain D

Receptor sequence

>6ppfD (length=167) Species: 1423 (Bacillus subtilis) [Search protein sequence]

KGILGRKIGMTQVFAEDLIPVTVIEAAPNVVLQKKTAENDGYEAIQLGFD
DKREKLSNKPEKGHVAKAETAPKRFVKELRGVEMDAYEVGQEVKVEIFSA
GEIVDVTGVSKGKGFQGALLPGRMGGEQITVQNLEIVKVDAERNLLLIKG
NVPGAKKSLITVKSAVK

3D structure

PDB

6ppf Structural consequences of the interaction of RbgA with a 50S ribosomal subunit assembly intermediate.

Chain

Resolution

3.4 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	D	M12 Q14 P24 Q37 D44 Y46 R57 K59 N62 K63 G67 H68 K71 R78 E82 R84 S114 K115 G116 G118 F119 R163 E167 Q168 T170 Q172 N173 N191 V192 K197	M10 Q12 P20 Q33 D40 Y42 R53 K55 N58 K59 G63 H64 K67 R74 E78 R80 S110 K111 G112 G114 F115 R123 E127 Q128 T130 Q132 N133 N151 V152 K157

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding

	Biological Process
GO:0006364	rRNA processing
GO:0006412	translation
GO:2000234	positive regulation of rRNA processing

	Cellular Component
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:6ppf, PDBe:6ppf, PDBj:6ppf
PDBsum	6ppf
PubMed	31665744
UniProt	P42920\|RL3_BACSU Large ribosomal subunit protein uL3 (Gene Name=rplC)

[Back to BioLiP]