Structure of PDB 6p1z Chain D |
>6p1zD (length=87) Species: 169683 (Phikzvirus phiKZ) [Search protein sequence] |
PGIAVCNMDSAGGVILPGPNVKCFYKGQPFAVIGCAVAGHGRTPHDSARM IQGSVKMAIAGIPVCLQGSMASCGHTATGRPNLTCGS |
|
PDB | 6p1z Structure and Biophysical Properties of a Triple-Stranded Beta-Helix Comprising the Central Spike of Bacteriophage T4. |
Chain | D |
Resolution | 2.099 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
ZN |
D |
H41 H46 C74 H76 |
H40 H45 C73 H75 |
|
|
|
|