Structure of PDB 6ozh Chain D

Receptor sequence

>6ozhD (length=239) Species: 7719 (Ciona intestinalis)

DEQIAEWNSKQEELRDKIIRSDGDFSLSKVKYVGGFDVSYSKINHELAVS
CMVVLSYPEMKQVYMNTTKVKLSCPYKSSYLAFREIEPFQQELQLLKAKK
PNLEPQVFLLDGNGFFHIRRCGAASHLGVLSNTRTIGVAKSLIEIPEDGV
KKTEVISQFKRLRKTGGNELDIISTEKNEVLAKAVLYAPKVEKPIFVSAG
HKCSLETAAKIVKGCTKTRIPEPIKMADKWSRKELKKIE

3D structure

• PDB: 6ozh Evolution of Inosine-Specific Endonuclease V from Bacterial DNase to Eukaryotic RNase.
• Chain: D
• Resolution: 3.026 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	dna	D	K48 V197 E198 K199 T224 R225 K231 K235	K42 V191 E192 K193 T218 R219 K225 K229
BS02	dna	D	Y46 K48 Y82 S84 S85 L87 N119 G128 A129 A145 K146 S147 I149 E150	Y40 K42 Y76 S78 S79 L81 N113 G122 A123 A139 K140 S141 I143 E144
BS03	CA	D	D43 D234	D37 D228
BS04	CA	D	D43 E91 D117	D37 E85 D111

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Sun Nov 17 02:35:17 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)

   1444         else:

=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)

   1446     

   1447     uniprot_line=''

pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '6ozh', asym_id = 'D', title = 'Evolution of Inosine-Specific Endonuclease V from Bacterial DNase to Eukaryotic RNase.'

 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='6ozh', asym_id='D', title='Evolution of Inosine-Specific Endonuclease V from Bacterial DNase to Eukaryotic RNase.')

    839 

    840     if go:

=>  841         display_go(go,uniprot,pdbid,asym_id)

    842     return pubmed,uniprot

    843 

global display_go = <function display_go>, go = '0004519,0006281', uniprot = '', pdbid = '6ozh', asym_id = 'D'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0004519,0006281', uniprot='', pdbid='6ozh', asym_id='D')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>