Structure of PDB 6ovh Chain D

Receptor sequence

>6ovhD (length=106) Species: 562 (Escherichia coli)

ADLEHNMHTLNDNLKHIEKADNATTVKDALTKMQAAAQDAWSATPPKLED
KSPDSPEMSDFRCGFWELIGQINAALHLAKQCKVKEAQAAAEQLKTTCNA
CHQKYR

3D structure

• PDB: 6ovh Constructing protein polyhedra via orthogonal chemical interactions.
• Chain: D
• Resolution: 2.6 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	HEC	D	E4 M7 C98 C101 H102 R106	E4 M7 C98 C101 H102 R106
BS02	ZN	D	A1 D39	A1 D39
BS03	ZN	D	D12 H16	D12 H16
BS04	ZN	D	H5 H8	H5 H8

Gene Ontology

Molecular Function

• GO:0005506 iron ion binding
• GO:0009055 electron transfer activity
• GO:0020037 heme binding
• GO:0046872 metal ion binding

Biological Process

• GO:0022900 electron transport chain

Cellular Component

• GO:0042597 periplasmic space

External links

• PDB: RCSB:6ovh, PDBe:6ovh, PDBj:6ovh
• PDBsum: 6ovh
• PubMed: 31969701
• UniProt: P0ABE7|C562_ECOLX Soluble cytochrome b562 (Gene Name=cybC)