Structure of PDB 6ok1 Chain D |
>6ok1D (length=127) Species: 471852 (Thermomonospora curvata DSM 43183) [Search protein sequence] |
RPAINRDNAFWFEAAKQRRLVIQRCAACKTLRHPPGPCCPHCGSFDWDTV EAAGTGQVYSYIVAHHPPHPAFEMPYVVALVELTEGTRLVTNLVGIAPDK IEIGMPVVLDWLEADPELTLPVFRPAV |
|
PDB | 6ok1 The steroid side-chain-cleaving aldolase Ltp2-ChsH2DUF35is a thiolase superfamily member with a radically repurposed active site. |
Chain | D |
Resolution | 1.7 Å |
3D structure |
|
|
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
ZN |
D |
C212 C215 C226 C229 |
C25 C28 C39 C42 |
|
|
|