Structure of PDB 6oig Chain D

Receptor sequence

>6oigD (length=296) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]

AFQKDAKSSAYSSRFQTPFRRRREGKTDYYQRKRLVTQHKAKYNTPKYRL
VVRFTNKDIICQIISSTITGDVVLAAAYSHELPRYGITHGLTNWAAAYAT
GLLIARRTLQKLGLDETYKGVEEVEGEYELTEAVEDGPRPFKVFLDIGLQ
RTTTGARVFGALKGASDGGLYVPHSENRFPGWDFETEEIDPELLRSYIFG
GHVSQYMEELADDDEERFSELFKGYLADDIDADSLEDIYTSAHEAIRADP
AFKPTEKKFTKEQYAAESKKYRQTKLSKEERAARVAAKIAALAGQQ

3D structure

PDB

6oig An open interface in the pre-80S ribosome coordinated by ribosome assembly factors Tsr1 and Dim1 enables temporal regulation of Fap7.

Chain

Resolution

3.8 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	D	K265 D266 Y272 R275 F276 Q277 R283 G286 Q292 R295 L296 K303 N305 T306 K308 Y309 R400 F402 F405 I408 P434 H435 N438 R439	K4 D5 Y11 R14 F15 Q16 R22 G25 Q31 R34 L35 K42 N44 T45 K47 Y48 R139 F141 F144 I147 P173 H174 N177 R178
BS02	rna	D	A262 F263 S270 S273 S274 T278 P279 F280 R281 R282 R284 K287 T288 Y290 R293 R314 T316 N317 K318 Q323 T328 I329 T330 G331 D332 V333 V334 Y339 H350 N354 R412 T414 T415 G416 A417 R418 Y458 Y467 E470 E481 L482 F483 T516 K518 F520 K522 Q524 Y525 A526 E528 S529 K530 Y532 R533 Q534 T535 K536 L537 K539 R542 R545 K549	A1 F2 S9 S12 S13 T17 P18 F19 R20 R21 R23 K26 T27 Y29 R32 R53 T55 N56 K57 Q62 T67 I68 T69 G70 D71 V72 V73 Y78 H89 N93 R151 T153 T154 G155 A156 R157 Y197 Y206 E209 E220 L221 F222 T255 K257 F259 K261 Q263 Y264 A265 E267 S268 K269 Y271 R272 Q273 T274 K275 L276 K278 R281 R284 K288

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome
GO:0005515	protein binding
GO:0008097	5S rRNA binding
GO:0019843	rRNA binding

	Biological Process
GO:0000027	ribosomal large subunit assembly
GO:0002181	cytoplasmic translation
GO:0006412	translation

	Cellular Component
GO:0005634	nucleus
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:6oig, PDBe:6oig, PDBj:6oig
PDBsum	6oig
PubMed	33219089
UniProt	P26321\|RL5_YEAST Large ribosomal subunit protein uL18 (Gene Name=RPL5)

[Back to BioLiP]