Structure of PDB 6o8w Chain D

Receptor sequence

>6o8wD (length=207) Species: 1351 (Enterococcus faecalis)

TKGILGKKVGMTQIFTESGELIPVTVVEATPNVVLQVKTVETDGYEAIQV
GYQDKREVLSNKPAKGHVAKANTAPKRFIKEFKNVELGEYEVGKEIKVDV
FQAGDVVDVTGTTKGKGFQGAIKRHGQSRGPMSHGSRYHRRPGSMGPVAP
NRVFKNKRLAGRMGGDRVTIQNLEVVKVDVERNVILIKGNIPGAKKSLIT
IKSAVKA

3D structure

• PDB: 6o8w Cryo-electron microscopy structure of the 70S ribosome from Enterococcus faecalis.
• Chain: D
• Resolution: 3.53 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	D	M12 Q14 P24 Q37 D44 Y46 R57 V59 K63 P64 G67 H68 K71 R78 E82 K84 K115 G116 K117 F119 Q120 G121 Q128 S129 R130 S134 H135 R138 Y139 H140 R141 G144 S145 M146 V149 A150 P151 R153 V154 K158 L160 R163 R168 T170 Q172 P193 K207	M11 Q13 P23 Q36 D43 Y45 R56 V58 K62 P63 G66 H67 K70 R77 E81 K83 K114 G115 K116 F118 Q119 G120 Q127 S128 R129 S133 H134 R137 Y138 H139 R140 G143 S144 M145 V148 A149 P150 R152 V153 K157 L159 R162 R167 T169 Q171 P192 K206

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:6o8w, PDBe:6o8w, PDBj:6o8w
• PDBsum: 6o8w
• PubMed: 33004869
• UniProt: A0A1B4XKR3