Structure of PDB 6nt2 Chain D

Receptor sequence
>6nt2D (length=330) Species: 9606 (Homo sapiens) [Search protein sequence]
PNAEDMTSKDYYFDSYAHFGIHEEMLKDEVRTLTYRNSMFHNRHLFKDKV
VLDVGSGTGILCMFAAKAGARKVIGIECSSISDYAVKIVKANKLDHVVTI
IKGKVEEVELPVEKVDIIISEWMGYCLFYESMLNTVLYARDKWLAPDGLI
FPDRATLYVTAIEDRQYKDYKIHWWENVYGFDMSCIKDVAIKEPLVDVVD
PKQLVTNACLIKEVDIYTVKVEDLTFTSPFCLQVKRNDYVHALVAYFNIE
FTRCHKRTGFSTSPESPYTHWKQTVFYMEDYLTVKTGEEIFGTIGMRPNA
KNNRDLDFTIDLDFKGQLCELSCSTDYRMR
3D structure
PDB6nt2 Anti-tumor Activity of the Type I PRMT Inhibitor, GSK3368715, Synergizes with PRMT5 Inhibition through MTAP Loss.
ChainD
Resolution2.48 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number 2.1.1.319: type I protein arginine methyltransferase.
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 SAH D Y57 M66 R72 G96 S97 I101 L102 E118 C119 K145 V146 M173 T176 Y16 M25 R31 G55 S56 I60 L61 E77 C78 K104 V105 M132 T135 BindingDB: IC50=550nM
BS02 KZS D Y57 I62 E65 M66 E162 W163 M164 E171 H311 Y16 I21 E24 M25 E121 W122 M123 E130 H270 PDBbind-CN: -logKd/Ki=8.82,Ki=1.5nM
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0005515 protein binding
GO:0008168 methyltransferase activity
GO:0008170 N-methyltransferase activity
GO:0008276 protein methyltransferase activity
GO:0008327 methyl-CpG binding
GO:0016274 protein-arginine N-methyltransferase activity
GO:0019899 enzyme binding
GO:0035241 protein-arginine omega-N monomethyltransferase activity
GO:0035242 protein-arginine omega-N asymmetric methyltransferase activity
GO:0042054 histone methyltransferase activity
GO:0042802 identical protein binding
GO:0044020 histone H4R3 methyltransferase activity
GO:0048273 mitogen-activated protein kinase p38 binding
GO:0106080 GATOR1 complex binding
GO:1904047 S-adenosyl-L-methionine binding
Biological Process
GO:0001701 in utero embryonic development
GO:0006338 chromatin remodeling
GO:0006479 protein methylation
GO:0006974 DNA damage response
GO:0007166 cell surface receptor signaling pathway
GO:0008284 positive regulation of cell population proliferation
GO:0008380 RNA splicing
GO:0018216 peptidyl-arginine methylation
GO:0019082 viral protein processing
GO:0030510 regulation of BMP signaling pathway
GO:0031175 neuron projection development
GO:0032259 methylation
GO:0045648 positive regulation of erythrocyte differentiation
GO:0045652 regulation of megakaryocyte differentiation
GO:0045653 negative regulation of megakaryocyte differentiation
GO:0045727 positive regulation of translation
GO:0046329 negative regulation of JNK cascade
GO:0046985 positive regulation of hemoglobin biosynthetic process
GO:0048738 cardiac muscle tissue development
GO:0051260 protein homooligomerization
GO:0061431 cellular response to methionine
GO:1900745 positive regulation of p38MAPK cascade
GO:1904263 positive regulation of TORC1 signaling
GO:1905168 positive regulation of double-strand break repair via homologous recombination
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005737 cytoplasm
GO:0005764 lysosome
GO:0005765 lysosomal membrane
GO:0005829 cytosol
GO:0016020 membrane
GO:0034709 methylosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6nt2, PDBe:6nt2, PDBj:6nt2
PDBsum6nt2
PubMed31257072
UniProtQ99873|ANM1_HUMAN Protein arginine N-methyltransferase 1 (Gene Name=PRMT1)

[Back to BioLiP]