Structure of PDB 6nj9 Chain D |
>6nj9D (length=95) Species: 8355 (Xenopus laevis) [Search protein sequence] |
RKTRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASR LAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTCYTSA |
|
PDB | 6nj9 Mechanism of Cross-talk between H2B Ubiquitination and H3 Methylation by Dot1L. |
Chain | D |
Resolution | 2.96 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
dna |
D |
S56 T88 |
S27 T59 |
|
|
|
|