Structure of PDB 6nbl Chain D

Receptor sequence

>6nblD (length=107) Species: 303 (Pseudomonas putida)

HSKVVYVSHDGTRRELDVACGVSLMQAAVSNGIYDIVGDCGGSASCATCH
VYVNEAFTDKVPAANEREIGMLESVTAELKPNSRLCCQIIMTPELDGIVV
DVPDRQW

3D structure

• PDB: 6nbl Ligand and Redox Partner Binding Generates a New Conformational State in Cytochrome P450cam (CYP101A1).
• Chain: D
• Resolution: 2.15 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	FES	D	G37 C39 G41 A43 S44 C45 C48 C86	G38 C40 G42 A44 S45 C46 C49 C87

Gene Ontology

Molecular Function

• GO:0005515 protein binding
• GO:0046872 metal ion binding
• GO:0051536 iron-sulfur cluster binding
• GO:0051537 2 iron, 2 sulfur cluster binding

Biological Process

• GO:0140647 P450-containing electron transport chain

Cellular Component

• GO:0005829 cytosol

External links

• PDB: RCSB:6nbl, PDBe:6nbl, PDBj:6nbl
• PDBsum: 6nbl
• PubMed: 30672701
• UniProt: P00259|PUTX_PSEPU Putidaredoxin (Gene Name=camB)