Structure of PDB 6nak Chain D

Receptor sequence
>6nakD (length=165) Species: 243274 (Thermotoga maritima MSB8) [Search protein sequence]
EEQKMRHLRFENLTEEQLKRLAKILTENLKGGEVVILSGNLGAGKTTFVK
GMIRAIGLDEKMVKSPTFTLMNVYPGLKTIYHLDLYRLQDTDFLSLDVED
ILEDEDGIMVVEWGDLFDGFWPEDSIKVKIEIADESHRNVEILIPEEVNF
LVEKIERYRKELQNT
3D structure
PDB6nak The structure of the TsaB/TsaD/TsaE complex reveals an unexpected mechanism for the bacterial t6A tRNA-modification.
ChainD
Resolution3.14 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 MG D T42 E108 T46 E112
BS02 APC D T10 E11 L14 L37 G38 A39 G40 K41 T42 T43 E108 S132 R134 T14 E15 L18 L41 G42 A43 G44 K45 T46 T47 E112 S136 R138
Gene Ontology
--> -->
 
 
UnboundLocalError		Python 3.6.8: /usr/bin/python3
Wed Dec 4 08:03:05 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)
   1444         else:
=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)
   1446     
   1447     uniprot_line=''
pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '6nak', asym_id = 'D', title = 'The structure of the TsaB/TsaD/TsaE complex reve...echanism for the bacterial t6A tRNA-modification.'
 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='6nak', asym_id='D', title='The structure of the TsaB/TsaD/TsaE complex reve...echanism for the bacterial t6A tRNA-modification.')
    839 
    840     if go:
=>  841         display_go(go,uniprot,pdbid,asym_id)
    842     return pubmed,uniprot
    843 
global display_go = <function display_go>, go = '0002949', uniprot = '', pdbid = '6nak', asym_id = 'D'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0002949', uniprot='', pdbid='6nak', asym_id='D')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>