Structure of PDB 6mus Chain D

Receptor sequence

>6musD (length=287) Species: 342948 (Thermococcus onnurineus)

MDRRFYGKIVIKGKIKAVTGLHIGSQRDISEIGGIANPVIKDPHTGLPYI
PGSSLKGRLRSLFEILVNSRLGEWREKYPSLANYSPGSCRPDNQENCGKF
FNRKINRGWIHVCPDYETALACPVCRLFGASGKESNFPSRIIVRDAFLTK
EWEEKWRAGEAITEAKIEVGIDRVTSQANPRTNERVVAGAEFEFEIIYNV
ENTTHWRDDIKNLLTAMALLEDSYLGGSGSRGYGKVKFIFDSFEFRPLDY
YRTGKDEDIVSIDAREKSVSDILSGFDSLFSEVEGKL

3D structure

• PDB: 6mus Type III-A CRISPR-Cas Csm Complexes: Assembly, Periodic RNA Cleavage, DNase Activity Regulation, and Autoimmunity.
• Chain: D
• Resolution: 3.6 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	D	I23 S53 S54 K56 G57 R58 R60 I105 G129 A130 S131 N136 S139 I167 E168 V169 I171 A178 R181 Y224 G226 G227 R231	I23 S53 S54 K56 G57 R58 R60 I105 G129 A130 S131 N136 S139 I167 E168 V169 I171 A178 R181 Y224 G226 G227 R231
BS02	rna	D	N37 N106 R107 K133 P180 R181	N37 N106 R107 K133 P180 R181
BS03	ZN	D	H111 C113 C122 C125	H111 C113 C122 C125

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0004519 endonuclease activity

Biological Process

• GO:0051607 defense response to virus

External links

• PDB: RCSB:6mus, PDBe:6mus, PDBj:6mus
• PDBsum: 6mus
• PubMed: 30503773
• UniProt: B6YWC0