Structure of PDB 6m4h Chain D

Receptor sequence
>6m4hD (length=88) Species: 9606 (Homo sapiens) [Search protein sequence]
SYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNK
RSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTS
3D structure
PDB6m4h Structural basis of nucleosome dynamics modulation by histone variants H2A.B and H2A.Z.2.2.
ChainD
Resolution3.9 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna D R86 S87 T88 R51 S52 T53
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Biological Process
GO:0002227 innate immune response in mucosa
GO:0006334 nucleosome assembly
GO:0019731 antibacterial humoral response
GO:0042742 defense response to bacterium
GO:0050830 defense response to Gram-positive bacterium
GO:0061844 antimicrobial humoral immune response mediated by antimicrobial peptide
Cellular Component
GO:0000786 nucleosome
GO:0005615 extracellular space
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005694 chromosome
GO:0005829 cytosol
GO:0070062 extracellular exosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6m4h, PDBe:6m4h, PDBj:6m4h
PDBsum6m4h
PubMed33073403
UniProtQ16778|H2B2E_HUMAN Histone H2B type 2-E (Gene Name=H2BC21)

[Back to BioLiP]