Structure of PDB 6lc1 Chain D

Receptor sequence

>6lc1D (length=86) Species: 9606 (Homo sapiens)

GRCAVCGDNASCQHYGVRTCEGCKGFFKRTVQKNAKYICLANKDCPVDKR
RRNRCQFCRFQKCLAVGMVKEVVRTDSLKGRRGRLP

3D structure

• PDB: 6lc1 Structural basis of NR4A1 bound to the human pituitary proopiomelanocortin gene promoter.
• Chain: D
• Resolution: 3.12 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	dna	D	Q277 H278 Y279 K292 Q296 V336 V337 R338 R346	Q13 H14 Y15 K28 Q32 V72 V73 R74 R82	PDBbind-CN: Kd=135.33nM
BS02	dna	D	E285 F290 R293 R316 N317 Q320 R323 R345 R346 G347 R348 P350	E21 F26 R29 R52 N53 Q56 R59 R81 R82 G83 R84 P86	PDBbind-CN: Kd=135.33nM
BS03	ZN	D	C267 C270 C284	C3 C6 C20
BS04	ZN	D	C303 C309 C319 C322	C39 C45 C55 C58

Gene Ontology

Molecular Function

• GO:0003700 DNA-binding transcription factor activity
• GO:0008270 zinc ion binding
• GO:0043565 sequence-specific DNA binding

Biological Process

• GO:0006355 regulation of DNA-templated transcription

External links

• PDB: RCSB:6lc1, PDBe:6lc1, PDBj:6lc1
• PDBsum: 6lc1
• PubMed: 31822342
• UniProt: P22736|NR4A1_HUMAN Nuclear receptor subfamily 4immunitygroup A member 1 (Gene Name=NR4A1)