Structure of PDB 6kal Chain D

Receptor sequence
>6kalD (length=443) Species: 9606 (Homo sapiens) [Search protein sequence]
PRVTVLVREFEAFDNAVPELVDSFLQQDPAQPVVVAADTLPYPPLALPRI
PNVRLALLQPALDRPAAASRPETYVATEFVALVPDGARAEAPGLLERMVE
ALRAGSARLVAAPVATANPARCLALNVSLREWTARYGAAPAAPRCDALDG
DAVVLLRARDLFNLSAPLARPVGTSLFLQTALRGWAVQLLDLTFAAARQP
PLATAHARWKAEREGRARRAALLRALGIRLVSWEGGRLEWFGCNKETTRC
FGTVVGDTPAYLYEERWTPPCCLRALRETARYVVGVLEAAGVRYWLEGGS
LLGAARHGDIIPWDYDVDLGIYLEDVGNCEQLRGAEAGSVVDERGFVWEK
AGDFFRVQYSESNHLHVDLWPFYPRNGVMTKDTWLDHRQDVEFPEHFLQP
LVPLPFAGFVAQAPNNYRRFLELKFGPGVIENPQYPNPALLSL
3D structure
PDB6kal Crystal structures of fukutin-related protein (FKRP), a ribitol-phosphate transferase related to muscular dystrophy.
ChainD
Resolution2.6 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number 2.7.8.-
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 ZN D C289 C296 C317 C318 C243 C250 C271 C272
BS02 C5P D G345 L348 R352 I357 W359 D360 Q437 V477 P481 Q482 Y483 P484 G299 L302 R306 I311 W313 D314 Q389 V429 P433 Q434 Y435 P436
BS03 MG D D362 D364 D316 D318
BS04 MG D D362 D364 D416 D316 D318 D368
Gene Ontology
Molecular Function
GO:0002162 dystroglycan binding
GO:0005515 protein binding
GO:0016740 transferase activity
GO:0016780 phosphotransferase activity, for other substituted phosphate groups
GO:0042802 identical protein binding
GO:0043236 laminin binding
GO:0046872 metal ion binding
Biological Process
GO:0001654 eye development
GO:0001701 in utero embryonic development
GO:0001764 neuron migration
GO:0003007 heart morphogenesis
GO:0003016 respiratory system process
GO:0006096 glycolytic process
GO:0006486 protein glycosylation
GO:0006600 creatine metabolic process
GO:0006629 lipid metabolic process
GO:0006936 muscle contraction
GO:0006954 inflammatory response
GO:0007417 central nervous system development
GO:0007420 brain development
GO:0007507 heart development
GO:0007519 skeletal muscle tissue development
GO:0007628 adult walking behavior
GO:0008104 protein localization
GO:0009100 glycoprotein metabolic process
GO:0009101 glycoprotein biosynthetic process
GO:0009410 response to xenobiotic stimulus
GO:0010001 glial cell differentiation
GO:0010467 gene expression
GO:0014823 response to activity
GO:0016485 protein processing
GO:0017038 protein import
GO:0019321 pentose metabolic process
GO:0019519 pentitol metabolic process
GO:0030198 extracellular matrix organization
GO:0030282 bone mineralization
GO:0035269 protein O-linked mannosylation
GO:0035437 maintenance of protein localization in endoplasmic reticulum
GO:0036058 filtration diaphragm assembly
GO:0036211 protein modification process
GO:0038026 reelin-mediated signaling pathway
GO:0042692 muscle cell differentiation
GO:0043010 camera-type eye development
GO:0043403 skeletal muscle tissue regeneration
GO:0043491 phosphatidylinositol 3-kinase/protein kinase B signal transduction
GO:0050905 neuromuscular process
GO:0051146 striated muscle cell differentiation
GO:0051262 protein tetramerization
GO:0051384 response to glucocorticoid
GO:0051674 localization of cell
GO:0060538 skeletal muscle organ development
GO:0060539 diaphragm development
GO:0061061 muscle structure development
GO:0061448 connective tissue development
GO:0071711 basement membrane organization
GO:0072592 oxygen metabolic process
GO:0097305 response to alcohol
GO:0097709 connective tissue replacement
GO:0098528 skeletal muscle fiber differentiation
Cellular Component
GO:0000139 Golgi membrane
GO:0005576 extracellular region
GO:0005615 extracellular space
GO:0005654 nucleoplasm
GO:0005737 cytoplasm
GO:0005783 endoplasmic reticulum
GO:0005791 rough endoplasmic reticulum
GO:0005794 Golgi apparatus
GO:0005829 cytosol
GO:0005886 plasma membrane
GO:0042383 sarcolemma
GO:0098723 skeletal muscle myofibril

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:6kal, PDBe:6kal, PDBj:6kal
PDBsum6kal
PubMed31949166
UniProtQ9H9S5|FKRP_HUMAN Ribitol 5-phosphate transferase FKRP (Gene Name=FKRP)

[Back to BioLiP]